Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 266aa    MW: 29331.6 Da    PI: 4.7236
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                     k++++t+eq++ Le+ Fe+++++  e+++eLA++lg+  rqV vWFqNrRa++k  76 KKRRLTAEQVQMLERSFEEENKLEPERKTELARRLGMAPRQVAVWFQNRRARWK 129
                                     56789************************************************9 PP

                     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeener 79 
                                     ekkrrl++eqv++LE+sFeee+kLeperK+elar+Lg+ prqvavWFqnrRAR+ktkqlE+d+++Lk+aydal+++++  75 EKKRRLTAEQVQMLERSFEEENKLEPERKTELARRLGMAPRQVAVWFQNRRARWKTKQLETDFDRLKAAYDALAADHQG 153
                                     69***************************************************************************** PP

                     HD-ZIP_I/II  80 LekeveeLreelke 93 
                                     L +++++Lr+++++ 154 LLADNDRLRAQVTS 167
                                     *********99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007118.23671131IPR001356Homeobox domain
SMARTSM003894.6E-1974135IPR001356Homeobox domain
PfamPF000462.0E-1776129IPR001356Homeobox domain
CDDcd000861.96E-1876132No hitNo description
PRINTSPR000314.2E-6102111IPR000047Helix-turn-helix motif
PROSITE patternPS000270106129IPR017970Homeobox, conserved site
PRINTSPR000314.2E-6111127IPR000047Helix-turn-helix motif
PfamPF021836.0E-16131173IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
Nucleic Localization Signal ? help Back to Top
No. Start End Sequence
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973433.11e-131PREDICTED: homeobox-leucine zipper protein HOX5-like
SwissprotQ6ZA744e-90HOX5_ORYSJ; Homeobox-leucine zipper protein HOX5
SwissprotQ9XH364e-90HOX5_ORYSI; Homeobox-leucine zipper protein HOX5
TrEMBLB4FLB11e-136B4FLB1_MAIZE; HB transcription factor
STRINGSi014228m1e-130(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.12e-52homeobox 1